SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317927|ref|YP_223780.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317927|ref|YP_223780.1|
Domain Number 1 Region: 27-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.14e-50
Family Phosphate binding protein-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62317927|ref|YP_223780.1|
Sequence length 349
Comment ABC transporter extracellular solute binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MSKKIKTMTVLAAVLLAGGALAAKADSIVYATTGGQMRQTLERAFYQPFAKESGTDVIPY
DIEVPDQWARVEAMKRAGKYDFDIVTATGPDLVDKADLLLTIDCSKLPNVEAKGLEGSCK
EKGVARTTGGMLLAYDASVYKDKVPQTWADFWDVKTFPGPRGLPDTGDRDWWLPAIALMA
DGVPRDKIFPMDLDRAYKKLDEIKPYISVWWKTGNQVAQIMRDQEVAMTMSYSGRALTAM
NEGAPFQLSWNDAIMDTGYFAILKDAPNPEGALKFINYFYGHAEGHPAFIKTANYATHSK
DGMALLPPEEQKNYATAPENFKLLMVPDFKWIGENRDMLRERWQNWLAE
Download sequence
Identical sequences A0A0F6AVS8 F8WJR5 Q2YJI9 Q8VQL5
gi|83269904|ref|YP_419195.1| 262698.BruAb2_1043 359391.BAB2_1062 430066.BAbS19_II09900 WP_002971932.1.100443 WP_002971932.1.101965 WP_002971932.1.102082 WP_002971932.1.10322 WP_002971932.1.10630 WP_002971932.1.10893 WP_002971932.1.11620 WP_002971932.1.12041 WP_002971932.1.12241 WP_002971932.1.13460 WP_002971932.1.13826 WP_002971932.1.14542 WP_002971932.1.14633 WP_002971932.1.15077 WP_002971932.1.16975 WP_002971932.1.17378 WP_002971932.1.18034 WP_002971932.1.18635 WP_002971932.1.19508 WP_002971932.1.19641 WP_002971932.1.20012 WP_002971932.1.20317 WP_002971932.1.22583 WP_002971932.1.2337 WP_002971932.1.24196 WP_002971932.1.24428 WP_002971932.1.24655 WP_002971932.1.24726 WP_002971932.1.25101 WP_002971932.1.25382 WP_002971932.1.25729 WP_002971932.1.26599 WP_002971932.1.2778 WP_002971932.1.2839 WP_002971932.1.2874 WP_002971932.1.2877 WP_002971932.1.28889 WP_002971932.1.31094 WP_002971932.1.31106 WP_002971932.1.31239 WP_002971932.1.32337 WP_002971932.1.32492 WP_002971932.1.32731 WP_002971932.1.33220 WP_002971932.1.33599 WP_002971932.1.33753 WP_002971932.1.34353 WP_002971932.1.35056 WP_002971932.1.35970 WP_002971932.1.37797 WP_002971932.1.38353 WP_002971932.1.39021 WP_002971932.1.39039 WP_002971932.1.39963 WP_002971932.1.40407 WP_002971932.1.40624 WP_002971932.1.40649 WP_002971932.1.40871 WP_002971932.1.41044 WP_002971932.1.41311 WP_002971932.1.41835 WP_002971932.1.4207 WP_002971932.1.42103 WP_002971932.1.42427 WP_002971932.1.43597 WP_002971932.1.4428 WP_002971932.1.45559 WP_002971932.1.46182 WP_002971932.1.46432 WP_002971932.1.4727 WP_002971932.1.47558 WP_002971932.1.47610 WP_002971932.1.4847 WP_002971932.1.48744 WP_002971932.1.50051 WP_002971932.1.50053 WP_002971932.1.50282 WP_002971932.1.5052 WP_002971932.1.5236 WP_002971932.1.53128 WP_002971932.1.53481 WP_002971932.1.5394 WP_002971932.1.54440 WP_002971932.1.54776 WP_002971932.1.54779 WP_002971932.1.55440 WP_002971932.1.55684 WP_002971932.1.56334 WP_002971932.1.56683 WP_002971932.1.56952 WP_002971932.1.57925 WP_002971932.1.58525 WP_002971932.1.58539 WP_002971932.1.59086 WP_002971932.1.59515 WP_002971932.1.61325 WP_002971932.1.61536 WP_002971932.1.61811 WP_002971932.1.61997 WP_002971932.1.63730 WP_002971932.1.64013 WP_002971932.1.64124 WP_002971932.1.64853 WP_002971932.1.64883 WP_002971932.1.64905 WP_002971932.1.65131 WP_002971932.1.65454 WP_002971932.1.6555 WP_002971932.1.65625 WP_002971932.1.66260 WP_002971932.1.66810 WP_002971932.1.67893 WP_002971932.1.67996 WP_002971932.1.67997 WP_002971932.1.68913 WP_002971932.1.69451 WP_002971932.1.69829 WP_002971932.1.70322 WP_002971932.1.71194 WP_002971932.1.71689 WP_002971932.1.71846 WP_002971932.1.7206 WP_002971932.1.72916 WP_002971932.1.75434 WP_002971932.1.75458 WP_002971932.1.76350 WP_002971932.1.77321 WP_002971932.1.77899 WP_002971932.1.78109 WP_002971932.1.78821 WP_002971932.1.7984 WP_002971932.1.79963 WP_002971932.1.80266 WP_002971932.1.80476 WP_002971932.1.80697 WP_002971932.1.81617 WP_002971932.1.81822 WP_002971932.1.82113 WP_002971932.1.8224 WP_002971932.1.82448 WP_002971932.1.8278 WP_002971932.1.8307 WP_002971932.1.83513 WP_002971932.1.85322 WP_002971932.1.8657 WP_002971932.1.87522 WP_002971932.1.87603 WP_002971932.1.87867 WP_002971932.1.8788 WP_002971932.1.88404 WP_002971932.1.8878 WP_002971932.1.90689 WP_002971932.1.91123 WP_002971932.1.91338 WP_002971932.1.91710 WP_002971932.1.92518 WP_002971932.1.93454 WP_002971932.1.93795 WP_002971932.1.94126 WP_002971932.1.94555 WP_002971932.1.94775 WP_002971932.1.97511 WP_002971932.1.97741 WP_002971932.1.98076 WP_002971932.1.98455 WP_002971932.1.99221 WP_002971932.1.99373 WP_002971932.1.99421 gi|62317927|ref|YP_223780.1| gi|189023178|ref|YP_001932919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]