SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62318001|ref|YP_223854.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62318001|ref|YP_223854.1|
Domain Number 1 Region: 24-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.26e-40
Family Phosphate binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62318001|ref|YP_223854.1|
Sequence length 319
Comment taurine ABC transporter taurine-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MKRRTFLAMSLALTFLPSVALADNIPVRVGYIADYWGTSITAIASEKGLWEKHGLDADTR
VFTNGPIQVQALGAGSLDFGYIGPGALWLPASGKAKIVAINSVGFSDRVIAQEGFKSMAD
LKGKKIGVPEGTSGDMLLRLALGKAGMKLDDVQVIKMDPSTVVSAFASKQIDAAGIWYPL
IGTIKEHVPGMVELAANSDFFPDKTFPSAFIARNEIVAENPEAVKRMIAVIEEAEDFRTA
NPEQSVDITAKFLKVDKANLETEAKNGKSLTSEELVKLTRDGSVNGWLSGMADMFVTFGK
LKSPLDPKDYYLADYFTAK
Download sequence
Identical sequences A0A0F6AW03 A0A0H3AUX1 A0A0M1WFH3 A0A1Z1ZSC7 A0A2D2BVD5 A0A2I7WWN7 A9MDA7 C0RMW2 C4IWY2 C7LJV4 N8N616 Q2YJB6 Q576E1 Q8FUN4 Q8YDR6
WP_002967147.1.100443 WP_002967147.1.100628 WP_002967147.1.100807 WP_002967147.1.101150 WP_002967147.1.101411 WP_002967147.1.102026 WP_002967147.1.102082 WP_002967147.1.10307 WP_002967147.1.1055 WP_002967147.1.10630 WP_002967147.1.10844 WP_002967147.1.10866 WP_002967147.1.11066 WP_002967147.1.11620 WP_002967147.1.11859 WP_002967147.1.11933 WP_002967147.1.12241 WP_002967147.1.12704 WP_002967147.1.12925 WP_002967147.1.12981 WP_002967147.1.13020 WP_002967147.1.1327 WP_002967147.1.13460 WP_002967147.1.13592 WP_002967147.1.13826 WP_002967147.1.14323 WP_002967147.1.14507 WP_002967147.1.14633 WP_002967147.1.15325 WP_002967147.1.16975 WP_002967147.1.1800 WP_002967147.1.18494 WP_002967147.1.19182 WP_002967147.1.19483 WP_002967147.1.19508 WP_002967147.1.19641 WP_002967147.1.19645 WP_002967147.1.20012 WP_002967147.1.20827 WP_002967147.1.22142 WP_002967147.1.22340 WP_002967147.1.22583 WP_002967147.1.23391 WP_002967147.1.24196 WP_002967147.1.24428 WP_002967147.1.24607 WP_002967147.1.24655 WP_002967147.1.2483 WP_002967147.1.24895 WP_002967147.1.24923 WP_002967147.1.24971 WP_002967147.1.25135 WP_002967147.1.25382 WP_002967147.1.25450 WP_002967147.1.26599 WP_002967147.1.27052 WP_002967147.1.2778 WP_002967147.1.27794 WP_002967147.1.2839 WP_002967147.1.2874 WP_002967147.1.29765 WP_002967147.1.29997 WP_002967147.1.31106 WP_002967147.1.31239 WP_002967147.1.31463 WP_002967147.1.31635 WP_002967147.1.31644 WP_002967147.1.31680 WP_002967147.1.32337 WP_002967147.1.32779 WP_002967147.1.33032 WP_002967147.1.33289 WP_002967147.1.33466 WP_002967147.1.33599 WP_002967147.1.33753 WP_002967147.1.3390 WP_002967147.1.33907 WP_002967147.1.34183 WP_002967147.1.34225 WP_002967147.1.34423 WP_002967147.1.35338 WP_002967147.1.35577 WP_002967147.1.35970 WP_002967147.1.36149 WP_002967147.1.36712 WP_002967147.1.38343 WP_002967147.1.38790 WP_002967147.1.39039 WP_002967147.1.39963 WP_002967147.1.40189 WP_002967147.1.40407 WP_002967147.1.40624 WP_002967147.1.40649 WP_002967147.1.408 WP_002967147.1.40871 WP_002967147.1.4091 WP_002967147.1.41044 WP_002967147.1.41105 WP_002967147.1.41344 WP_002967147.1.41835 WP_002967147.1.41893 WP_002967147.1.41941 WP_002967147.1.42065 WP_002967147.1.42427 WP_002967147.1.42633 WP_002967147.1.42774 WP_002967147.1.4295 WP_002967147.1.43006 WP_002967147.1.43058 WP_002967147.1.43148 WP_002967147.1.4319 WP_002967147.1.43597 WP_002967147.1.43689 WP_002967147.1.43928 WP_002967147.1.44045 WP_002967147.1.44060 WP_002967147.1.4428 WP_002967147.1.44294 WP_002967147.1.44541 WP_002967147.1.45559 WP_002967147.1.46182 WP_002967147.1.46432 WP_002967147.1.47516 WP_002967147.1.47545 WP_002967147.1.47558 WP_002967147.1.47610 WP_002967147.1.47843 WP_002967147.1.48075 WP_002967147.1.48184 WP_002967147.1.48396 WP_002967147.1.48727 WP_002967147.1.48744 WP_002967147.1.48948 WP_002967147.1.49089 WP_002967147.1.49542 WP_002967147.1.49753 WP_002967147.1.49942 WP_002967147.1.50051 WP_002967147.1.50053 WP_002967147.1.50282 WP_002967147.1.5052 WP_002967147.1.50924 WP_002967147.1.50952 WP_002967147.1.51553 WP_002967147.1.52027 WP_002967147.1.5236 WP_002967147.1.52478 WP_002967147.1.52541 WP_002967147.1.53128 WP_002967147.1.53481 WP_002967147.1.53843 WP_002967147.1.5394 WP_002967147.1.54440 WP_002967147.1.54481 WP_002967147.1.54776 WP_002967147.1.54779 WP_002967147.1.55047 WP_002967147.1.55284 WP_002967147.1.55440 WP_002967147.1.55585 WP_002967147.1.55684 WP_002967147.1.5609 WP_002967147.1.56313 WP_002967147.1.56334 WP_002967147.1.56621 WP_002967147.1.56683 WP_002967147.1.56687 WP_002967147.1.56947 WP_002967147.1.56952 WP_002967147.1.57541 WP_002967147.1.57564 WP_002967147.1.57925 WP_002967147.1.58260 WP_002967147.1.58539 WP_002967147.1.58868 WP_002967147.1.59086 WP_002967147.1.59091 WP_002967147.1.5971 WP_002967147.1.60134 WP_002967147.1.60631 WP_002967147.1.60920 WP_002967147.1.61081 WP_002967147.1.61536 WP_002967147.1.61543 WP_002967147.1.61811 WP_002967147.1.61961 WP_002967147.1.61997 WP_002967147.1.62592 WP_002967147.1.62990 WP_002967147.1.62997 WP_002967147.1.63628 WP_002967147.1.63730 WP_002967147.1.63732 WP_002967147.1.64013 WP_002967147.1.64124 WP_002967147.1.6440 WP_002967147.1.64585 WP_002967147.1.64849 WP_002967147.1.64905 WP_002967147.1.65131 WP_002967147.1.65199 WP_002967147.1.65299 WP_002967147.1.65454 WP_002967147.1.65501 WP_002967147.1.6555 WP_002967147.1.65597 WP_002967147.1.65651 WP_002967147.1.66078 WP_002967147.1.66260 WP_002967147.1.66268 WP_002967147.1.66407 WP_002967147.1.66647 WP_002967147.1.66810 WP_002967147.1.66855 WP_002967147.1.67107 WP_002967147.1.67659 WP_002967147.1.67893 WP_002967147.1.67996 WP_002967147.1.67997 WP_002967147.1.68488 WP_002967147.1.6942 WP_002967147.1.69522 WP_002967147.1.69829 WP_002967147.1.69997 WP_002967147.1.70160 WP_002967147.1.70322 WP_002967147.1.70570 WP_002967147.1.70760 WP_002967147.1.71002 WP_002967147.1.71194 WP_002967147.1.71228 WP_002967147.1.71846 WP_002967147.1.72189 WP_002967147.1.72916 WP_002967147.1.73628 WP_002967147.1.73739 WP_002967147.1.7388 WP_002967147.1.74236 WP_002967147.1.75128 WP_002967147.1.75434 WP_002967147.1.75458 WP_002967147.1.75563 WP_002967147.1.75678 WP_002967147.1.76350 WP_002967147.1.76433 WP_002967147.1.7667 WP_002967147.1.76877 WP_002967147.1.77281 WP_002967147.1.77321 WP_002967147.1.77685 WP_002967147.1.77899 WP_002967147.1.78109 WP_002967147.1.78225 WP_002967147.1.78590 WP_002967147.1.78716 WP_002967147.1.79327 WP_002967147.1.7984 WP_002967147.1.79963 WP_002967147.1.79993 WP_002967147.1.80059 WP_002967147.1.80167 WP_002967147.1.80266 WP_002967147.1.80365 WP_002967147.1.80697 WP_002967147.1.81276 WP_002967147.1.81377 WP_002967147.1.81558 WP_002967147.1.81617 WP_002967147.1.81674 WP_002967147.1.82113 WP_002967147.1.82205 WP_002967147.1.8223 WP_002967147.1.8224 WP_002967147.1.82390 WP_002967147.1.82565 WP_002967147.1.82753 WP_002967147.1.8278 WP_002967147.1.82834 WP_002967147.1.82990 WP_002967147.1.8307 WP_002967147.1.83513 WP_002967147.1.84207 WP_002967147.1.84540 WP_002967147.1.84601 WP_002967147.1.84764 WP_002967147.1.85684 WP_002967147.1.85721 WP_002967147.1.85753 WP_002967147.1.8657 WP_002967147.1.86832 WP_002967147.1.86901 WP_002967147.1.87222 WP_002967147.1.87603 WP_002967147.1.87867 WP_002967147.1.88404 WP_002967147.1.88424 WP_002967147.1.88658 WP_002967147.1.8878 WP_002967147.1.88867 WP_002967147.1.89113 WP_002967147.1.90689 WP_002967147.1.9096 WP_002967147.1.91081 WP_002967147.1.91123 WP_002967147.1.91338 WP_002967147.1.9163 WP_002967147.1.91710 WP_002967147.1.91768 WP_002967147.1.91958 WP_002967147.1.92383 WP_002967147.1.92518 WP_002967147.1.93367 WP_002967147.1.93454 WP_002967147.1.93795 WP_002967147.1.94126 WP_002967147.1.94513 WP_002967147.1.94648 WP_002967147.1.94775 WP_002967147.1.95141 WP_002967147.1.95178 WP_002967147.1.95770 WP_002967147.1.96661 WP_002967147.1.96710 WP_002967147.1.97240 WP_002967147.1.97320 WP_002967147.1.97331 WP_002967147.1.97511 WP_002967147.1.97741 WP_002967147.1.97860 WP_002967147.1.98076 WP_002967147.1.98362 WP_002967147.1.98455 WP_002967147.1.98764 WP_002967147.1.99373 WP_002967147.1.99421 gi|225686927|ref|YP_002734899.1| gi|17988453|ref|NP_541086.1| gi|83269977|ref|YP_419268.1| gi|189023254|ref|YP_001932995.1| gi|161621229|ref|YP_001595115.1| gi|148558551|ref|YP_001258034.1| gi|376279121|ref|YP_005109154.1| gi|384447302|ref|YP_005661520.1| 204722.BRA1186 224914.BMEII0109 262698.BruAb2_1122 359391.BAB2_1146 430066.BAbS19_II10690 444178.BOV_A1089 483179.BCAN_B1217 546272.BMEA_B1181 568815.BMI_II1192 gi|256015945|ref|YP_003105954.1| gi|23500899|ref|NP_700339.1| gi|376277305|ref|YP_005153366.1| gi|23500899|ref|NP_700339.1| gi|376270531|ref|YP_005113576.1| gi|62318001|ref|YP_223854.1| gi|384213706|ref|YP_005602789.1| gi|384410810|ref|YP_005599430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]