SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378835835|ref|YP_005205111.1| from Mycoplasma hyorhinis GDL-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378835835|ref|YP_005205111.1|
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.49e-50
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 243-340
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00000000647
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378835835|ref|YP_005205111.1|
Sequence length 396
Comment DNA polymerase IV [Mycoplasma hyorhinis GDL-1]
Sequence
MKIIAHIDINNFFASAEEKLVPSLKNKPIAIARKEANSIAVSLSKTAKKLGAKTPDKLFN
IQKKIPNLITIEPDHIYYSFLSKEFFAFIRQNISRKLEVFSIDECFVDLSDYYRYFHSLE
TMLNDIKNQIWKHLKLPITIGISYNKFLAKMATNLAKKEGVSFKLINKKNKKEALFDLDI
ANMFGIGKSLSYQLKKENINTISDFLKTNIEDERLIKILGTRRFYFFDNLLKKGDDEIEL
SHQIKSLSHTKTFKKEEILNFKTLYSLIKQFIFDLCEKLKKKYLHTNKIQLFYKTRNSQN
IKINHKLEHFSDDANFIYQQIIPFLDKINNFEDIWIMGITFLNIQQNEAKISKSQTNNKV
KKIINKVNQQFQDVQVRSLADFEIGQKINDFNKKIF
Download sequence
Identical sequences gi|385858286|ref|YP_005904797.1| gi|558671955|ref|YP_008808664.1| gi|378835835|ref|YP_005205111.1| WP_014335558.1.33442 WP_014335558.1.37317 WP_014335558.1.46618 WP_014335558.1.49344 WP_014335558.1.74169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]