SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378835861|ref|YP_005205137.1| from Mycoplasma hyorhinis GDL-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378835861|ref|YP_005205137.1|
Domain Number 1 Region: 135-214
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.5e-24
Family Translational machinery components 0.00041
Further Details:      
 
Domain Number 2 Region: 63-131
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.5e-21
Family Ribosomal S5 protein, N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378835861|ref|YP_005205137.1|
Sequence length 223
Comment 30S ribosomal protein S5 [Mycoplasma hyorhinis GDL-1]
Sequence
MENQKKEEQVVKTEKMKSTQTVVVSKESVDKKQASDKSNASKNEAKTFKRKPGFAKKDKT
QFQSEFEEKVIDIARVTTVVKGGRRFSFSAYAVVGNKKGKVGYGHGKANEVQDAIKKAVK
DAQNRLITVPIVNKSTIPHEISEKFLASKVLLKPAPKGKGIIASNTVRAVVELAGYTDIY
TKTHGSRTKINTVHATIKALQKLRTVEDIAWARDIEVEKLTQN
Download sequence
Identical sequences K7XYV0
gi|385858878|ref|YP_005905389.1| gi|378835861|ref|YP_005205137.1| gi|558671983|ref|YP_008808692.1| gi|423262976|ref|YP_007013001.1| WP_014335576.1.33442 WP_014335576.1.37317 WP_014335576.1.46618 WP_014335576.1.49344 WP_014335576.1.74169 WP_014335576.1.89735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]