SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378836136|ref|YP_005205412.1| from Mycoplasma hyorhinis GDL-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378836136|ref|YP_005205412.1|
Domain Number 1 Region: 177-704
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.68e-173
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000181
Further Details:      
 
Domain Number 2 Region: 18-176
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 4.32e-48
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378836136|ref|YP_005205412.1|
Sequence length 721
Comment ribonucleoside-diphosphate reductase subunit alpha [Mycoplasma hyorhinis GDL-1]
Sequence
MTKKQVDNNTLTGSVSEEYITLNAKSKLFLKYKESYKFDQQAADSYIKHHIEPRYRKFNS
VRERITWLIENDYYDEKVINEYTFEELEKLTQEAYKYKHHFPSFMGALKFYSSYALKSND
SQEYLEHFQERALLNALFLAKGNSERASSILRQIMLGRFQPATPTFLNAGKKNRGEYVSC
YLIRIEDNMESISRAVTTSLQLSKRGGGVSILLSNLREMGAPIKKIENQATGVIPVMKIL
EDSFSYANQLGQRQGAGAVYLNVHHPDILSFLDTKRENADEKIRIKSLSLGVVIPDITFE
LAKDNKDMALFSVYDVEREYKKAFSDISITQEYYKMLENPNIKKNFINARKLFTTIAELH
FESGYPYILFDDTVNRRNAHKNRIVMSNLCSEIVQPSTPSEYLPDLTFTKKGEDICCNLG
SLNIDKAMESGKEFGELVYQAIVSLDHVSRTSDLSSAPSIENGNNKNHAVGLGAMNLHGF
LATNHIYYDSKEALDFTNIFFYTMAYHAFKSSSILAQKFGAFEHFKESKFADGSYFDKYT
KVSEKEYQPKTQKIKEVFEKYQVTIPTKQDWIELVENIKRVGIANSHLMAVAPTGSISYL
SSCTPSLQPVVAPVETRKEGKIGRVYVPAYKMNQENMKFYSLGAYELGPDPIIDIAAEAQ
KHIDQSISLTLFLKDTATTRDLNKAYIRAFKKGCGSIYYVRIRQEVLEDSENYDECEACV
I
Download sequence
Identical sequences E0TLP3 K7X3J0
gi|558672293|ref|YP_008809002.1| gi|385858551|ref|YP_005905062.1| gi|304373443|ref|YP_003856652.1| gi|378836136|ref|YP_005205412.1| WP_013302477.1.33442 WP_013302477.1.37317 WP_013302477.1.46618 WP_013302477.1.74169 WP_013302477.1.85631 WP_013302477.1.89735 gi|423263290|ref|YP_007013315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]