SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91778402|ref|YP_553610.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91778402|ref|YP_553610.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 4.71e-79
Family Acetamidase/Formamidase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91778402|ref|YP_553610.1|
Sequence length 410
Comment formamidase FmdA [Burkholderia xenovorans LB400]
Sequence
MAETLIKVDLNQSAYDNENVHNRWHPDIPMACWVNPGDDFILETYDWTGGFVKNNDSADD
VRDIDLSIVHFLSGPVGVKGAEPGDLLVVDLLDIGAKQESQWGFNGFFSKKNGGGFLTDH
FPQAQKSIWDFHGLYTSSRHIPGVNFAGLIHPGLIGCLPDPKMLATWNEREAALIATDPQ
RVPGLANPPFAATAHMGRLAGDERAKAAAEGARTVPPREHGGNCDIKDLSRGSKVYFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVELIKGGMEKYGIRNPIFKPSPITP
HYNDYLIFEGISVDEQGKQHYLDVHIAYRQACLNAIEYLKKFGYSGAQAYSILGTAPVQG
HISGVVDVPNACATLWLPTQIFDFDIRPNSAGPVKHITGGVDLPLSPDLV
Download sequence
Identical sequences Q13NS9
WP_011491600.1.38508 WP_011491600.1.45576 gi|91778402|ref|YP_553610.1| 266265.Bxe_B1706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]