SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91778853|ref|YP_554061.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91778853|ref|YP_554061.1|
Domain Number 1 Region: 258-398
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.36e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0037
Further Details:      
 
Domain Number 2 Region: 40-121
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.18e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.017
Further Details:      
 
Domain Number 3 Region: 408-504
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.66e-16
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 4 Region: 126-215,244-307
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.87e-16
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91778853|ref|YP_554061.1|
Sequence length 510
Comment putative oxidoreductase [Burkholderia xenovorans LB400]
Sequence
MPQPCPPHRMLGPSRDAKPVSVLNQATPSPVLSDAAPTPRPSACPGLLRIVAARDGGICR
IKLPGGELSAAQARAIAEASARHAAGVIELTNRANVQVRGVKRGEEAVLIAALVGAGLGP
TSIAADDVRNVMISPAAGRDPSALLDTRPLCAALLAMLQSEARFAALSPKFALLLDGGER
LARVDHPHDVWLAASRETDGVRFVFGLAGCPPASASASAAANASAAAFSGSPTQSDHITT
EQSHANGTGPLAAILPSQASALVRALLLTFLDLAAADTTRMRHLLTLHSAHALLHHAQQY
VDFPLTRNVSPADWHRSTPADAGLRLGAHAQRQPGTWHVGGQPASGRLDADTLHALAALS
QQHGDGTLRVTPWQSVLLPDIATHAVPPVLSGLNALDLACDPAQAITRLIACAGSSGCAK
SLADTKTDALRLARRLPAGVEAHLSGCPRSCAAAHCAPYTLLAAAPGLYDLYRRDRHDGR
PGFGECVARQLTIDQAADMLDRLARSNTNA
Download sequence
Identical sequences Q13MH8
gi|91778853|ref|YP_554061.1| WP_011492031.1.38508 WP_011492031.1.45576 266265.Bxe_B1245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]