SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91779174|ref|YP_554382.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91779174|ref|YP_554382.1|
Domain Number 1 Region: 143-304
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 439-581
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 1-149
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.27e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.021
Further Details:      
 
Domain Number 4 Region: 345-451
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.09e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91779174|ref|YP_554382.1|
Sequence length 595
Comment putative nitrite/sulfite reductase [Burkholderia xenovorans LB400]
Sequence
MYQYTEFDKSFVRSRAAQFRDQVERWQSGKLSENDFRPLRLQNGWYVQRHAPMLRVAVPY
GELSSSQLRVLARIAREYDEPEAEVYRLACEAQRKLGTLRLPTHYAHFTTRTNVQFNWIP
LSKAADVMDLLASVDMHGIQTSGNCIRNISCDERAGVAPDEIADPRPFAEIMRQWTTLHP
EFAFLPRKFKIAITGAAEDRAATEWHDVGLRLIRNEAGELGFRVTVGGGMGRTPMIGAVL
REFLPWQQIMNYIEAVVRVYNRYGRRDNKYKARIKILVKAEGQRYVDDVNEEFRQIVEFD
GGPHTIAQAELDRVSASFVPPALHKRTPANVGGVRPDLHAQAEIHPRFGKWLERNVALHK
DPQMRVVTLSFKRLLQAPGDASADQLDTVAELAARYSAGEARVTHTQNVVLPWVHVDDLF
PLWQAASDADLASANVHLLTDMIACPGGDFCALANARSIPVAQAIAERYQDLDELDDIGE
IDLHISGCINSCGHHHSGHIGILGVDKDGQEWYQVTLGGADGENSSGVAQPGKVIGPSFS
AHEIPDVVEAILSTYRDVRSADGTRETFIQTVRRVGLEPFKLAANGARCKTEVSL
Download sequence
Identical sequences Q13LK7
WP_011492335.1.38508 WP_011492335.1.45576 266265.Bxe_B0922 gi|91779174|ref|YP_554382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]