SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91779489|ref|YP_554697.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91779489|ref|YP_554697.1|
Domain Number 1 Region: 5-116,163-336
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.62e-88
Family Acetamidase/Formamidase-like 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91779489|ref|YP_554697.1|
Sequence length 343
Comment acetamidase/formamidase [Burkholderia xenovorans LB400]
Sequence
MLHELPAIEKNVHWGYFDAALAPALIVESGDFVRAEAVTHHAGDAPELMMDDRVRALYDT
IPEADRQPGVHLMTGPIFVKDAKPGDLLEVRYLQMIPRFNYGSNLAAHWGHLFTDFEKER
VTIYELDQASNTAHALYAYDYPGKYLVPGKRSEIRDCCRELALEGIRVPVRPHLGTAGVA
PDVAGRVSTVPPGAHGGNIDNWRIGAGSTMYYPVAVDGGLFSIGDPHVSQGDGEISGTAI
EASLNVMFQIVLRRDFTFPSPLLETPDYWIVHGFDEDLDVATKNASRDMLLLLTGQQGLS
RDDAYSLMSVAADFSVTQVVDGRQGIHCKIPRSIFPPKKKPRA
Download sequence
Identical sequences I2IVZ2 Q13KP2
266265.Bxe_B0603 gi|91779489|ref|YP_554697.1| WP_007178116.1.38508 WP_007178116.1.45576 WP_007178116.1.83274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]