SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91782630|ref|YP_557836.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91782630|ref|YP_557836.1|
Domain Number 1 Region: 73-379,460-488
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.44e-66
Family Type II chitinase 0.0000915
Further Details:      
 
Domain Number 2 Region: 386-458
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000427
Family Chitinase insertion domain 0.0034
Further Details:      
 
Domain Number 3 Region: 525-613
Classification Level Classification E-value
Superfamily PKD domain 0.000000149
Family PKD domain 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|91782630|ref|YP_557836.1|
Domain Number - Region: 618-696
Classification Level Classification E-value
Superfamily PKD domain 0.000863
Family PKD domain 0.0056
Further Details:      
 
Domain Number - Region: 717-796
Classification Level Classification E-value
Superfamily PKD domain 0.00235
Family PKD domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91782630|ref|YP_557836.1|
Sequence length 861
Comment glycosyl hydrolase family chitinase [Burkholderia xenovorans LB400]
Sequence
MTQLNDSTSAGGSVQQGRQNSKLVYNGDPGDKSGAKGATEKKYQMNGYKPATEVEKFSYT
SGRVAKRVYNGYKPNDTKVFGYYTDWSQYDGRYDGDFADDSCGRGIDLMLLDAKAYDKLV
LGFAGIIGDKGEKQNTINRAATDFGRKKDEATFVDAWGDVASYRNCGFPGWVSNDYQALF
HQETAQGVLGGLRKLKTKNPDLVLSFSIGGWTMSEAFHWVVAESARRKTLINSILDLFKR
FPMFGAIDLDWEYPAAEGNDGNTYSDADTPNFQALVRELRQAFDGARRNDVMISIAASAA
LSKMKKADLKGMLDAGVHGINLMTYDFFGTPWAPKIAHHTNLHPSHPSDPNEFSIDAALD
YLIQTGVPLNRVAIGYAAYSRSARNAKLTSLSPLEGTYDPGTGTTTGSFESGTTEWYDLI
YNYLDLENQRGINGYDVYTDEIADADYLYSKDSKLFISVDTPRTVKAKGEYARQRGLAGL
FTWTIDMDGGVLVNAAREGLGNEITKQTIDMSPFYFKGINVQGGNRPPVAAIDGPLEAFA
GDAVHFSGKRSNDPDGDALTYLWSAPGLSFDGATTVEVDGVVPTGAATSFTVKLTVNDGH
GNTNTAQVKLTVKSKSGQPPVARMTVQLASGTAFQLSGTASFDPDGDPLSYAWEAPQLPF
DGSHEAVVSGVVPSVAKTTDYLIQLSVSDGTSTSSEAIYLEATPSSGGSVKAVITGKTNV
ESGAPLSLSGADSTGPAPLVYKWSAPGLSFDGSDQASVTVTAPTLTKTTAYPVQLTVTGH
GGDGAQSVASVTVTVVAGQSAGTWKPQDYPGGSVVTHDYQGQGLRKYCALWWANRSDEPG
NPDCTSKQKYDGKVWQDLGNA
Download sequence
Identical sequences Q142F5
266265.Bxe_A3196 WP_011487505.1.38508 WP_011487505.1.45576 gi|91782630|ref|YP_557836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]