SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91785597|ref|YP_560803.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91785597|ref|YP_560803.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.96e-99
Family Methylenetetrahydrofolate reductase 0.000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91785597|ref|YP_560803.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Burkholderia xenovorans LB400]
Sequence
MNPIELSFEFFPPKTQEGVDKLRATRAQLATLKPKFVSVTFGAGGSTQQGTLDTVVDMAK
EGLEAAPHVSCIGSSKESLRAILNEYRAHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEFGDWFCIEVAGYPEYHPQSRSPRQDLENFARKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWIARRLESFGDDRESIRAFGLDV
VTDLCRRLIDAKVPGLHFYTLNGAAATKAICERLNV
Download sequence
Identical sequences Q13T38
WP_011490174.1.38508 WP_011490174.1.45576 266265.Bxe_A0180 gi|91785597|ref|YP_560803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]