SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91777477|ref|YP_552685.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91777477|ref|YP_552685.1|
Domain Number 1 Region: 12-264
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.28e-51
Family Phosphate binding protein-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91777477|ref|YP_552685.1|
Sequence length 282
Comment polar amino acid ABC transporter periplasmic ligand-binding protein [Burkholderia xenovorans LB400]
Sequence
MSKRRLSSLVLAALFPFGALIHPLAANADTLDDIKSRGTMTVAIDPTFAPYEYTDANNNI
VGFDPAVMDAVARHLGVKIEYQRMSFSGIIPGLLAHSFDVEGSALNVTSERAKRLAYVVP
TSKTVNGALVRSDFRKIPQPATIESLAGLTAAVKSASAPEQILKQFNETLKAKGLAPIQL
ISVDSVDQTVAALMTRRADFVFDDMTVLAGVIKQNPGKLKSTGELGPSQWIAWATRPDDT
RLNKAISDQILAMKKSGELARLQKANLGVTFDTPTSDFIPAQ
Download sequence
Identical sequences Q13RF4
266265.Bxe_B2658 WP_011490704.1.38508 WP_011490704.1.45576 gi|91777477|ref|YP_552685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]