SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91779170|ref|YP_554378.1| from Burkholderia xenovorans LB400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91779170|ref|YP_554378.1|
Domain Number 1 Region: 441-580
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.62e-32
Family Flavohemoglobin, C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 335-434
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.08e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00049
Further Details:      
 
Domain Number 3 Region: 567-677
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-18
Family 2Fe-2S ferredoxin-related 0.027
Further Details:      
 
Domain Number 4 Region: 175-294
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000019
Family PNP-oxidase like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91779170|ref|YP_554378.1|
Sequence length 691
Comment putative oxidoreductase [Burkholderia xenovorans LB400]
Sequence
MSANSTDNAVSPWHAGELKLQRAVGVAERMQEVGRRVIRRLMPDQHRAFFPQLPFVALGA
VDHEGDVWATLVAGKPGFLHAPTARTLRVDLVRDPHDPASAGLDDGEAVGLLGIELHTRR
RNRLNGTVSHSAGAGFNVDVTQSFGNCPQYIQMRDAEFVRDPASPPPVEAVQLEHLSERA
RTMIDTADTFFVASYVDDPAGRQVDVSHRGGKAGFVRLSEDGVLTIPDFAGNLFFATLGN
FVINPRAGLVFADFESGDLLQLTGEAQVDLDSPEIAAFQGAERLWRFKPRRIVYRAGALP
LRWKLQANGWSPNSLMTGSWDEVASRVKAQALADAWRPFKVTQVVDESSVIRSFYLEPLD
GAGLIPHAAAQHLPIRVTLPGCTKPVIRTYTLSTAPADGSYRISVKRQGLVSAHLHDTLR
VGSVIEARAPAGQFTIDAAARRSAVLLAAGVGVTPMLAMLRHIVYEGLRTRRVRPTWFFH
SARTLAERAFTKEIDQLAASAGGAVRVVRTLTDTEGAQMGKDFDASGRLDVELLRATLPF
NDYDFYLCGPAGFMQSLYDGLRELNVADNRIHAEAFGPAGLHRRADAGADAGLAHLPADK
PVPVAFVKSGKEARWNPDSGSLLDLAESRGLSPEFGCRGGSCGTCRTRVLEGAVAYPVAP
EFKVASDEALICCAVPAQAGTSGAERLLLDL
Download sequence
Identical sequences Q13LL1
266265.Bxe_B0926 gi|91779170|ref|YP_554378.1| WP_011492331.1.38508 WP_011492331.1.45576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]