SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385858797|ref|YP_005905308.1| from Mycoplasma hyorhinis MCLD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385858797|ref|YP_005905308.1|
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily PTS system IIB component-like 2.33e-20
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385858797|ref|YP_005905308.1|
Sequence length 95
Comment Pentitol phosphotransferase enzyme II, B component [Mycoplasma hyorhinis MCLD]
Sequence
MANLKVIAACGNGMGTSMIIKLKVQKILKELNIPADVDALSMGQSKGMTNSVDIIISSKH
LTSEFVQNQKAKIIGVTNLMDENEIRQALKQALNL
Download sequence
Identical sequences K7X9T4
gi|558672060|ref|YP_008808769.1| WP_014335625.1.33442 WP_014335625.1.37317 WP_014335625.1.46618 WP_014335625.1.49344 WP_014335625.1.74169 WP_014335625.1.89735 gi|423263054|ref|YP_007013079.1| gi|385858797|ref|YP_005905308.1| gi|378835931|ref|YP_005205207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]