SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83719107|ref|YP_441463.1| from Burkholderia thailandensis E264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83719107|ref|YP_441463.1|
Domain Number 1 Region: 45-178
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 4.05e-51
Family Ecotin, trypsin inhibitor 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83719107|ref|YP_441463.1|
Sequence length 179
Comment ecotin [Burkholderia thailandensis E264]
Sequence
MKSASRLAAWAACAAFAGFSAAASAASTSTHAAGADAASSPKPSAEDIKMFPAAQAGQKR
EVIVLPAEKLEEDIRVELVVGKTIKVDCNQHWFGGDLKHETVQGWGYPYYVLADAKGPAA
TLMACPGQEPQEAFVPVRGSGYLLRYNSRLPIVVYVPKEFEVRYRLWYGSNEVARAVEK
Download sequence
Identical sequences A0A1B4JTX3 Q2T036
gi|83719107|ref|YP_441463.1| 271848.BTH_I0907 WP_011401901.1.101337 WP_011401901.1.21694 WP_011401901.1.22957 WP_011401901.1.28510 WP_011401901.1.28912 WP_011401901.1.31764 WP_011401901.1.44093 WP_011401901.1.49905 WP_011401901.1.66095 WP_011401901.1.68421 WP_011401901.1.6992 WP_011401901.1.7190 WP_011401901.1.77623 WP_011401901.1.80240 WP_011401901.1.83779 WP_011401901.1.88085 WP_011401901.1.8909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]