SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83719787|ref|YP_443480.1| from Burkholderia thailandensis E264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83719787|ref|YP_443480.1|
Domain Number 1 Region: 21-288
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 6.59e-98
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000184
Further Details:      
 
Domain Number 2 Region: 357-446
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 3.79e-16
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0011
Further Details:      
 
Domain Number 3 Region: 289-334
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000135
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83719787|ref|YP_443480.1|
Sequence length 460
Comment ubiquinol-cytochrome c reductase, cytochrome b [Burkholderia thailandensis E264]
Sequence
MATDNKEISTTGLLGWVDRRFPLTSTWKQHLSEYYAPKNFNVWYFFGSLALLVLVNQIVT
GIFLTMNYKPDSTLAFASVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLLYGSY
RKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFVGPDLSLWIR
GDYVVSDVTLNRFFAFHVIAIPLVLLLLVVAHLIALHEVGSNNPDGIEIKEKKDEKGVPL
DGIPFHPYYSVHDFFGVCVFLMVFALIVFFMPEMGGYFLEANNFIPANPLQTPPEIAPVW
YFTAFYAMLRATTDPFKIVLMIVIAALGLLALVRARGKWKIALPVLAAALVVFMYFTESK
FWGVVVMGGAVVTLFFLPWLDRSPVKSIRYRPFFHKVFFGIFVAVFLTLAFLGTRPPSPA
ATLIAQVCALVYFAFFLGMPFWTRLGTFKQPPERVRFKSH
Download sequence
Identical sequences A0A2C5VDP9 Q2SUB9
WP_009888565.1.101337 WP_009888565.1.21694 WP_009888565.1.22957 WP_009888565.1.28510 WP_009888565.1.28912 WP_009888565.1.31764 WP_009888565.1.44093 WP_009888565.1.49905 WP_009888565.1.66095 WP_009888565.1.68421 WP_009888565.1.6992 WP_009888565.1.7190 WP_009888565.1.83779 WP_009888565.1.8909 271848.BTH_I2976 gi|83719787|ref|YP_443480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]