SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83720093|ref|YP_443534.1| from Burkholderia thailandensis E264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83720093|ref|YP_443534.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.8e-31
Family Frataxin-like 0.0000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83720093|ref|YP_443534.1|
Sequence length 108
Comment frataxin-like protein [Burkholderia thailandensis E264]
Sequence
MSDTDYLTRAEAVLAAVERSVDAANDGDADVDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAAKAGGFHYRFVDGAWRDTRSGDEFFAALTGFATQQAGMPIAFSA
Download sequence
Identical sequences A0A096YVA6 A0A2C5VDK4 Q2SU65
gi|83720093|ref|YP_443534.1| 271848.BTH_I3030 WP_009888466.1.101337 WP_009888466.1.21694 WP_009888466.1.22957 WP_009888466.1.28510 WP_009888466.1.28912 WP_009888466.1.31764 WP_009888466.1.44093 WP_009888466.1.49905 WP_009888466.1.66095 WP_009888466.1.68421 WP_009888466.1.6992 WP_009888466.1.7190 WP_009888466.1.83779 WP_009888466.1.8909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]