SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83721207|ref|YP_441913.1| from Burkholderia thailandensis E264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83721207|ref|YP_441913.1|
Domain Number 1 Region: 50-306
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.06e-43
Family Proline dehydrohenase domain of bifunctional PutA protein 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83721207|ref|YP_441913.1|
Sequence length 321
Comment proline dehydrogenase superfamily protein [Burkholderia thailandensis E264]
Sequence
MNNEIKTLAAAALKGFAANPQYSQRFRQGTALREWLQVPASRYIVAGDAGTAVDRMRLLA
GKGYEVGLEYVGENVTDRDEVRRIEAQYLQLIDLLPHGGLGRRTELNFDLSNVGLLIAPD
LACEVTGRIVAAADEKGAFVTLSMERFPMVDDILSVFHRLAASHANIGITLQAYLHRTPD
DLDAVLRTGRKIRLVKGVYDEIPERALPRSPALDDRYAELARRMTDAGIDRSFATQDPAL
IERLMRDGLLADRAEIEMLHGVQPTRLRDLRRDGVKCRVYGTFGDNWYLHFLHRLAEAPE
TVLQALADIHDPSRIVFGGEY
Download sequence
Identical sequences A0A2C5VZV9 Q2SYT6
gi|83721207|ref|YP_441913.1| WP_009889361.1.101337 WP_009889361.1.21694 WP_009889361.1.22957 WP_009889361.1.28510 WP_009889361.1.28912 WP_009889361.1.31764 WP_009889361.1.44093 WP_009889361.1.49905 WP_009889361.1.66095 WP_009889361.1.68421 WP_009889361.1.6992 WP_009889361.1.7190 WP_009889361.1.83779 WP_009889361.1.8909 271848.BTH_I1366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]