SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83721387|ref|YP_443793.1| from Burkholderia thailandensis E264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83721387|ref|YP_443793.1|
Domain Number 1 Region: 646-1098
Classification Level Classification E-value
Superfamily ALDH-like 7.59e-127
Family ALDH-like 0.000000304
Further Details:      
 
Domain Number 2 Region: 258-606
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.57e-119
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000063
Further Details:      
 
Domain Number 3 Region: 88-257
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 6.67e-64
Family N-terminal domain of bifunctional PutA protein 0.000000408
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000000005
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Weak hits

Sequence:  gi|83721387|ref|YP_443793.1|
Domain Number - Region: 1144-1292
Classification Level Classification E-value
Superfamily ALDH-like 0.000257
Family ALDH-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83721387|ref|YP_443793.1|
Sequence length 1309
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia thailandensis E264]
Sequence
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGMA
DLSDGHADGDEDGAPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASL
APDVQSMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDAL
IRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLI
RKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASY
EQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYD
IGLNIDAEEADRLELSLDLLEALCFDSELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRS
RHRLMIRLVKGAYWDSEVKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQF
ATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHE
TLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEEAAKVVPLGAPHAKIALPREL
YGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAEPRDVRNPADLR
DVVGTVSEATPEEVGAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVR
EAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVA
AALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRA
VMFTGSTEVARLINKTLSSRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSF
DSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDA
HIAAMKDKGHAVTQLEMPEACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLD
KLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSG
TGPKAGGALYLQRLLATRPAGLPRSLEASLVADAPQEGETRDNPSAALTALRDWLIEQRE
PALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAVLAT
GNRALFASAAGEALAAALPAPLKAHAAVRKQADAAFDAVLFEGDSDELLALVKEVAQRPG
PIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences A0A2C5VYP3 Q2STF6
271848.BTH_I3301 WP_009910285.1.22957 WP_009910285.1.28510 WP_009910285.1.28912 WP_009910285.1.31764 WP_009910285.1.44093 WP_009910285.1.49905 WP_009910285.1.66095 WP_009910285.1.68421 WP_009910285.1.6992 WP_009910285.1.7190 WP_009910285.1.83779 WP_009910285.1.8909 gi|83721387|ref|YP_443793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]