SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83721420|ref|YP_443657.1| from Burkholderia thailandensis E264

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83721420|ref|YP_443657.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.24e-100
Family Methylenetetrahydrofolate reductase 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83721420|ref|YP_443657.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Burkholderia thailandensis E264]
Sequence
MNPIELSFEFFPPKTAEGVDKLRATRAQLAPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
AGLEAAPHLSCIGSSKDSLRAILDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFRIEVAAYPEYHPQARSPKADLENFARKVKAGANAAITQYFYNADAYFRFVD
DAAKLGVDVPVVPGIMPITNFSQLMRFSEMCGAEVPRWIARRLESFGDDKDSIRAFGADV
VTGLCRRLIDAGVPGLHFYTLNGAAATKAVCERLGL
Download sequence
Identical sequences A0A2C5VUK9 Q2STU2
271848.BTH_I3163 gi|83721420|ref|YP_443657.1| WP_009906536.1.18625 WP_009906536.1.21694 WP_009906536.1.22957 WP_009906536.1.28186 WP_009906536.1.28510 WP_009906536.1.28912 WP_009906536.1.31764 WP_009906536.1.42613 WP_009906536.1.43935 WP_009906536.1.44093 WP_009906536.1.49905 WP_009906536.1.58271 WP_009906536.1.66095 WP_009906536.1.68421 WP_009906536.1.6992 WP_009906536.1.7190 WP_009906536.1.83779 WP_009906536.1.8909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]