SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392388592|ref|YP_005907001.1| from Mycoplasma leachii 99/014/6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392388592|ref|YP_005907001.1|
Domain Number 1 Region: 6-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.22e-79
Family Ribosomal protein L1 0.000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392388592|ref|YP_005907001.1|
Sequence length 226
Comment 50S ribosomal protein L1 [Mycoplasma leachii 99/014/6]
Sequence
MAKISKRFKEALSKVEKNKVYPLNEALDLAKQTSTTKFDSTVEVAFNLNIDPRKADQQIR
GAVVLPAGTGKTQRVLVLTNTKTKEAEQAKADIVGGEELINRIKNENWFDFDIIVATPEM
MAKLGAIGKILGPKGLMPNPKTGTVTIDVAKAVDDIKKGKVEYRADKEGNIHLIIGKVSF
ESEKLEENFKAVIDEIRRVKPQTVKGDYIKNITLSTTMGPGIKVQF
Download sequence
Identical sequences E4PT79
gi|313664994|ref|YP_004046865.1| gi|392388592|ref|YP_005907001.1| WP_013447425.1.23723 WP_013447425.1.53025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]