SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392388746|ref|YP_005907155.1| from Mycoplasma leachii 99/014/6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392388746|ref|YP_005907155.1|
Domain Number 1 Region: 3-233
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.22e-66
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000436
Further Details:      
 
Domain Number 2 Region: 240-354
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 3.73e-21
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392388746|ref|YP_005907155.1|
Sequence length 406
Comment DNA polymerase IV [Mycoplasma leachii 99/014/6]
Sequence
MFNKTIIHIDMDAFFASCMQLKHPELKNKPVVISNSFDKSIISTASYEARKYNIKAAMPL
FKAKKLYPQIISVKPDMIFINNISYQIWDFIKNNYTNKIEVASIDEAYLDVSDLVKNTSV
LILAKNIQKDIYDQFNLTCSIGIGFNRFSAKMSTSLDKPNGITLTTTSNFKDSIWPISIN
KMYGFGQSAAKLLNNTKIKTIKDLALLSDVEVYQLLNKKGLALKKEALGLGSDYINYLSN
DYKSISKETTLNTPIYQYDEIETIILNLSKFISYKLHKNQLLCKTIEIKIRYKIDEKLFD
KQKNLASRHKQITLKNHTNDFEKIYNSALDCFYSLYEQNKGILLIGVGVSKLIHKNQNWV
QLDIENQTKVDKNQIDNALKIENMIFDINKKFKKPVIFKAKDLKKI
Download sequence
Identical sequences E4PU47
gi|392388746|ref|YP_005907155.1| WP_013447730.1.23723 WP_013447730.1.53025 gi|313665312|ref|YP_004047183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]