SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392389267|ref|YP_005907676.1| from Mycoplasma leachii 99/014/6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392389267|ref|YP_005907676.1|
Domain Number 1 Region: 163-236
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 6.28e-17
Family Glucose permease domain IIB 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|392389267|ref|YP_005907676.1|
Domain Number - Region: 35-114
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00432
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392389267|ref|YP_005907676.1|
Sequence length 240
Comment PTS system transporter subunit IIBC [Mycoplasma leachii 99/014/6]
Sequence
MYFAIPKENRKIYGTGIISALLPSALSGATESIEFTFLFTDPLLFVIHIFYTGFTYMFMY
LCDFAQVSTRGSGIITWAIVNLINARNIQGFWGLFVIGPLMMGIYFVTFYFMIIKLNFKT
PGRDKNTAKPISKKEYKQAKQLEKQKLETKQKDIKEDEFDNEFINNIIIGCGGAENIKIM
ANCVTRLRVTMHDISKFDKSIVDKTKPYGYKEISNQVQIIYGPKVTTIATLVKEKLGIEG
Download sequence
Identical sequences E4PSM2
gi|313665669|ref|YP_004047540.1| WP_013448055.1.23723 WP_013448055.1.53025 gi|392389267|ref|YP_005907676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]