SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392389391|ref|YP_005907800.1| from Mycoplasma leachii 99/014/6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392389391|ref|YP_005907800.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.27e-40
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392389391|ref|YP_005907800.1|
Sequence length 152
Comment PTS system fructose-specific transporter subunit IIA [Mycoplasma leachii 99/014/6]
Sequence
MNKEIFNINHVFIDVDVNSKKQAFEIIALKFYLLGFTTDKNKALKGLKKREKEGSTGFND
GIAIPHAKIKEITKPGIFVFKFKNGVEWDSIDNSLVTIAIALAIPENDSANDHLKILSSI
ARKLVDDDFRKDLNKANNVDQLYQLISKVEII
Download sequence
Identical sequences WP_014584604.1.23723 gi|392389391|ref|YP_005907800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]