SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392389410|ref|YP_005907819.1| from Mycoplasma leachii 99/014/6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392389410|ref|YP_005907819.1|
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 7.06e-37
Family Isochorismatase-like hydrolases 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392389410|ref|YP_005907819.1|
Sequence length 166
Comment pyrazinamidase/nicotinamidase [Mycoplasma leachii 99/014/6]
Sequence
MKSQNKNKALIIVDYQYDFCDPNGSLYVKNAYTLKSKIEKLAKDLKSQGWTIIATKDFHP
IDHCSFKIWNKHCIQNTKGSELYFDHSDVDLIIEKGVNKDIESYSGFFDDANNSNGLDEY
LKSKNIDTLKIVGVATEICVKANYDDAIKLGYDVEVDLEYCKGFTD
Download sequence
Identical sequences E4PSW2
gi|313665759|ref|YP_004047630.1| WP_013448143.1.23723 WP_013448143.1.53025 gi|392389410|ref|YP_005907819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]