SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|107026942|ref|YP_624453.1| from Burkholderia cenocepacia AU 1054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|107026942|ref|YP_624453.1|
Domain Number 1 Region: 2-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.69e-107
Family FMN-linked oxidoreductases 0.00000000219
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.53e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000145
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.64e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|107026942|ref|YP_624453.1|
Sequence length 677
Comment NADH:flavin oxidoreductase [Burkholderia cenocepacia AU 1054]
Sequence
MTTPFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLAEYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLMTSAAARRHREITGAVHAEDGKIALQILHTGRYGYHPFAVAPS
KIKSPISPFAPHELSARGVERQIRAFVRCATLAREAGYDGVEIMGSEGYLINQFISMHTN
KRTDQWGGSYENRIRLPIEIVERTREAVGRDFILIYRLSMLDLIPDGSDWSETVQLAKVV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEVAEQ
ILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGCNQACLDHAFKNKIASCLLNP
RACHETELKYTPAPQPKRIAVVGAGPAGLACSTVLAQRGHQVDLFDGAAEIGGQFNMAKR
IPGKEEFHEALSYFGRQVELTGVKLHLNRRVDASDLIAGGYDEIVLATGVAPRDPKIPGQ
DGPNVFSYIDVLAGKQPVGRRVAVVGAGGIGFDVAEYLVQEGESPALDLDEWKAEWGVTD
PATTRGGVTRAQVSAPTREVTLLQRKAAPLGKGLGKTTGWIRRATLKMKQVKMIGGVNYE
LIDARGLHVSYGEQRTDHELIEADTIVLCTGQEPQRALLAPLQAAGRSVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences A0A0H2XWV7 A0A1U9MX01
gi|116691861|ref|YP_837394.1| 331271.Bcen_4599 331272.Bcen2424_3764 gi|107026942|ref|YP_624453.1| WP_011548245.1.27194 WP_011548245.1.43430 WP_011548245.1.5376 WP_011548245.1.96618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]