SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|107024376|ref|YP_622703.1| from Burkholderia cenocepacia AU 1054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|107024376|ref|YP_622703.1|
Domain Number 1 Region: 5-274
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.88e-100
Family Methylenetetrahydrofolate reductase 0.000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|107024376|ref|YP_622703.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Burkholderia cenocepacia AU 1054]
Sequence
MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLEAAPHLSCIGSSRDSLRAILDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFHIEVAGYPEYHPQSRSPKADLENFARKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARRLESFGDDRESIRAFGADV
VTNLCQRLIDAGVPGLHFYTLNLATATRTICERLAV
Download sequence
Identical sequences A0A0H2XSP5 A0A1U9MM84
gi|107024376|ref|YP_622703.1| gi|116688298|ref|YP_833921.1| WP_011546700.1.101155 WP_011546700.1.27194 WP_011546700.1.34550 WP_011546700.1.43430 WP_011546700.1.44577 WP_011546700.1.5376 WP_011546700.1.64260 WP_011546700.1.78666 WP_011546700.1.90247 WP_011546700.1.96618 331271.Bcen_2833 331272.Bcen2424_0274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]