SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479198718|ref|YP_007827944.1| from Fretibacterium fastidiosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479198718|ref|YP_007827944.1|
Domain Number 1 Region: 288-508
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-42
Family ABC transporter ATPase domain-like 0.0000853
Further Details:      
 
Domain Number 2 Region: 85-278
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000837
Family DNA repair protein MutS, domain III 0.009
Further Details:      
 
Domain Number 3 Region: 712-781
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000759
Family Smr domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479198718|ref|YP_007827944.1|
Sequence length 784
Comment Mismatch repair ATPase (MutS family) [Fretibacterium fastidiosum]
Sequence
MRADPSVLELLEFRKALSPLRERLGGELGALALDRLAPAEDFAHLSRRADLLKEWQDLLD
AQGAPQWSADLPAVTPLFEGARRSGILSGGELLMVRALMGAAKRVRDGLADAPNPALEAL
RRRLRDFAPEIEALSVVEDTGRLADRASPKLAQIREALESLKRSGRRTAERLLNDPNVLN
MLQERTLAWRDGRFLLLVRQEYVNRFPGLAVERSSSGNSVYMEPRMLSSINNGLLMRTHE
ERDEEQLILLDLTRKVLARAGALDAAERVLGELDLMTACDGLVRGRGWIVPALSRKRGLR
LVGARHPMLKDAAVPVDVSCGEDEGFSTLVVTGPNTGGKTVVLKTVGVLLLMAWCGLPVP
ARDGTRIGSFDAVFADIGDEQSIEQNLSTFSAHLRKIVGILRDATRQSVVLLDELGAGTD
PQEGAALGTAILETLRGRGCTTLATTHHNPIKQYALTTPGVETASMEFDAERLAPTYRLL
MGVPGKSNALAIARRYGMPEEVLNRAQGELAARGVSAEELMGELVERRAALDQAERSFQE
TVRETERLRQAYQDRVREIDGQRDSIMEAADRRAEQLLSRAEAASKGMIRDLEETVKMRA
SQGLEGRRQEIRRIRSGIDRRRDRRVEREIASRPASFSVEPGVTVQVAGSGIVGVVESVK
NGRAALMAGPMRVEVPLEQLAPTEKKARVAVPPPNAEAMSRAETVPSSIMVRGMDVGTAM
PLVEGYLDRAYRANHTSVTVIHGRGEGILRREVHALCSRLKYVKDFRLGGEGEGGFGVTV
VSFR
Download sequence
Identical sequences D4MA03
gi|479198718|ref|YP_007827944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]