SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479198750|ref|YP_007827976.1| from Fretibacterium fastidiosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479198750|ref|YP_007827976.1|
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily AF1862-like 3.92e-20
Family Cas Cmr5-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479198750|ref|YP_007827976.1|
Sequence length 109
Comment CRISPR-associated protein, Cmr5 family [Fretibacterium fastidiosum]
Sequence
MGIRTKEQQMAQAAFERVQGRNSGFEEYSSFALAFPSLVHSCGLAQALAFAQAKGRADYL
SDLENVLGEGGDLCARSREAEVMEYMRLSRRALAASSWIKRYCQAKGGN
Download sequence
Identical sequences D4MA35
gi|479198750|ref|YP_007827976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]