SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479198873|ref|YP_007828099.1| from Fretibacterium fastidiosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479198873|ref|YP_007828099.1|
Domain Number 1 Region: 85-153
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.88e-30
Family CO dehydrogenase ISP C-domain like 0.00013
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.62e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479198873|ref|YP_007828099.1|
Sequence length 160
Comment Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Fretibacterium fastidiosum]
Sequence
MTRITLTLNDEKRIADVDADTRLIDMLRDEFRLVSVREGCGAGECGVCTVLLDEMAVCSC
LVPAIQADGHKITTIEGLEKDGELDVLQQAFIDCDATQCGFCTPGMILSTKALLLQNACP
SREEIKRTLAGNVCRCTGYIPILNAVETAARRIAARGEKR
Download sequence
Identical sequences D4MAF8
gi|479198873|ref|YP_007828099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]