SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_00828 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_00828
Domain Number 1 Region: 561-813
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.42e-99
Family N-acetyl transferase, NAT 0.000000125
Further Details:      
 
Domain Number 2 Region: 179-245
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000062
Family PHD domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_00828
Sequence length 834
Comment | BC1G_00828 | Botrytis cinerea histone acetyltransferase MYST2 (835 aa)
Sequence
MAGAAAAVVLMDGEPSRSLATSEDDADFEEDDDMVPDIINEDANAYAANIQLQNGLIGDH
SDLEDDREGPEGEEDMLTDEDADGEEDDEMLDGPDNMDHTEEEEADENRELGEGDEDDDD
AEGVGAVKIQPGLEDDDDEDAESGSDSDSSVEIEQDDESKGSSDVEEETRWQSNGEGEEE
EEEHVNPNRCIFCEQDEDDDPSEEFELYLACEMCGDNAHRQCARNSNALKSDEEAEKWYC
PGCHENSLVPGSPSADVDMLEGPEEEIVEAVGQEGDGVELLDEDASIAAKRRISRDRVPG
DLLPPRRGTIKSDSHSVFEQLIPPEDPMDGSRLLRKRKTSSVEADEGLVLRKRTRDRDVL
PDNSKPSFDEPHDEAKVDNDSNLSLTNGKRNKKRVDTPTSPRVSRSLRQKTSSSLGPPVN
IVEKIPGTLKISFRVDPMELRHILSIPPKPKKKRGGRGVSKARSTATSTALVPSSYSQPF
YPSIHEKELEELKSKPYGGILSEADADTSLTLPRAEHRRQFEDARQTAEEDWKARAAAAA
EAAAKAGLRKARKVSGPASQIEYIDFGAYQIDIWYAAPYPEEYSRNKALFICEFCLKYME
SDIVAWRHKTKCPWKHPPGDEIYRDGKIMIFEVDGRKNPLYCQNLCLLAKLFLGSKTLYY
DVEPFLFYVMTEYDELGCHFVGYFSKEKRPSSLNNVSCILVLPIHQRKGYGHLLIDFSYL
LTRVEKKTGSPEKPLSDMGLVSYRNYWRLVLCYYLQRFQPSERVPSIKAISDEMGLTPDD
VISGLDAMGTLVRDPTTGTYAMRLKPDYYKEVICHHEAKGRNDSIVRQNDHRGW
Download sequence
Identical sequences XP_001560800.1.26476 BC1T_00828 332648.A6RK57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]