SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_01452 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_01452
Domain Number 1 Region: 10-200
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000704
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BC1T_01452
Sequence length 234
Comment | BC1G_01452 | Botrytis cinerea N-acetyltransferase 9 (235 aa)
Sequence
MSKSKGENRTVSTNKILLVPYEKSHVITYHEWMKDEEIQQATASEPLSLEEEYDMQRSWR
TDHDKLTFIICLPEERDASQVIRKGVSDAPARMIGDVNLFISEADEDEEGCIGEIEIMIA
ELSARGKGLGRSAVVAFLEYLRRNLEKVLEEYRKGIQGKKEEGKMKLLQLRVKIGGKNVT
SIGLFESLGFVKVGEGENYFGEVELVFEGWCGEERVKGLMERFGVEGYQECGYR
Download sequence
Identical sequences BC1T_01452 XP_001559893.1.26476 332648.A6RLY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]