SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BC1T_01902 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_01902
Domain Number 1 Region: 141-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000588
Family N-acetyl transferase, NAT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BC1T_01902
Sequence length 224
Comment | BC1G_01902 | Botrytis cinerea predicted protein (225 aa)
Sequence
MPIHHDPLFPTFTLSSSNPLHQNLILTRPRTSDAKNSISAFANPAVFLNLTGPPFPYTQD
DFDSFFTEVLDKSSRLAAAELWDAKSAQEDGSPVQKWVGAIPFPSIREVRVGEKGERIEE
FVGQIEIRRRGFVTTIDKEEREKLAGESANRKTGDPGIEWEIGFWLLPSHHGRAIMPAVL
QSLISEFFIPYMNLNFLTGEYLEFNKASNRVFEKCGWASEVGDG
Download sequence
Identical sequences 332648.A6RN80 XP_001559746.1.26476 BC1T_01902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]