SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_02035 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_02035
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.19e-23
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_02035
Sequence length 208
Comment | BC1G_02035 | Botrytis cinerea conserved hypothetical protein (209 aa)
Sequence
MTLTLRPATAVDAEALTNIYFSAFSADEISLLCFPRSSVTWAWWYNSVITEIQDPSSHFL
CIYDSSSPTSKIVSYAKWNDTSAPVATINDLPEWPQGCDVDVANHFFGTLIERRREIMGE
RKHWYLEIIATRPEWQSKGAAGKLMRWGLEKADEEGVETYLEASPVGKEVYEHFGFEEKA
RLVVPVNGNNDFVECMMVRSKKEKVNDA
Download sequence
Identical sequences BC1T_02035 XP_001559371.1.26476 332648.A6RNL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]