SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BC1T_02592 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_02592
Domain Number 1 Region: 22-175
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.74e-23
Family N-acetyl transferase, NAT 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_02592
Sequence length 185
Comment | BC1G_02592 | Botrytis cinerea hypothetical protein similar to glucosamine-6-phosphate acetyltransferase (186 aa)
Sequence
MASSEITLFANDLISEECQNSLPEGYKFRALQRSDFHRGYLGVLRDLAYVGPITEEQWEE
RFDAMKKCEDTYYVLVIVKEKGGENDGEFIMGTGTLVVEMKFLGNLGLQGHVEDVCISAD
HQGQQFGTKLIKALDHIASERGCYKSILDCGAKKIPFYEKCGYEGRGFEMHHYHDPENEA
ALNGV
Download sequence
Identical sequences G2Y793 M7UBR2
332648.A6RQ69 BC1T_02592 XP_001558958.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]