SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_02957 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_02957
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.06e-26
Family N-acetyl transferase, NAT 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BC1T_02957
Sequence length 200
Comment | BC1G_02957 | Botrytis cinerea predicted protein (201 aa)
Sequence
MSFPNPIFRTENLTLRPAVPSDAASLAAIFANPLNTQHEPHKPSSPTVEEYQGRIAKWND
LRVSGKAYFLVITRPPTTETGSGSLPAGGVIGFGGINAISADAQGKRIADLGVLIDSSEW
RKGYGREALQATLDFAFRQVEAEGVGCDEAFFETLAMNTPFQRLADRMGMTKWKRVKSDG
KEVEYRFSKEDWEGIKKQSS
Download sequence
Identical sequences BC1T_02957 332648.A6RRT0 XP_001558293.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]