SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_03339 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_03339
Domain Number 1 Region: 34-77,109-180
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.36e-19
Family N-acetyl transferase, NAT 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_03339
Sequence length 192
Comment | BC1G_03339 | Botrytis cinerea predicted protein (193 aa)
Sequence
MAYEIIHISSEDLVRAYVGKYKEFRLLSLQVAPEAFASSYSREAAFPDEVWYERLANPHA
ATYFALENSKIIGTVSVLGPLIYGPEDMTVLGNPWQAIGDKTSNIQAMGHYRMNGVFTLP
DVRGQGVGKALVEAALKYAGGQAAVQGKAFVCSIVVESDNAGAQRLYERCGFVAMKEVPN
GETSVILMKIPG
Download sequence
Identical sequences G2YKM8 M7TZC4
XP_001558490.1.26476 BC1T_03339 332648.A6RR98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]