SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_03490 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_03490
Domain Number 1 Region: 6-48,92-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000141
Family N-acetyl transferase, NAT 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_03490
Sequence length 159
Comment | BC1G_03490 | Botrytis cinerea hypothetical protein similar to N-acetyltransferase (160 aa)
Sequence
MAEQAVIRHARREDVPGILTLIHELAAYEHESASVLATPSSLSKTIAFAPSPLVSPSNTT
PSTGDSISPTRPARCLLLFPPSPPSSSSSSSSPQTPEPIGMALYFYNYSTWRASAGIYLE
DLYVRDSERGKGYGSRLLSVLAKEVVDMEGGRLEWNDEG
Download sequence
Identical sequences BC1T_03490 XP_001557908.1.26476 332648.A6RSR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]