SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_04626 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_04626
Domain Number 1 Region: 6-95,136-207
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.26e-17
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_04626
Sequence length 231
Comment | BC1G_04626 | Botrytis cinerea predicted protein (232 aa)
Sequence
MNPLFSIHPCTPTDLPSMLNIYNLAFANDPFRLARWPESQVPPSVFTSWLTKVFTKYLST
PHTHTWKLVENSTGNMAGWTHWAEPHVVSREEEERNKMEEEKEERERKERGEGKFPEGSV
LEICEAKVAGWNRLREKWYKREDMFLIYFLSISPSYQKLGLGTLLLTSITNLADAQSKIS
YLEATAAGYPVYVRAGFRELECMEVDLGTWGVGRNWAMVRGEGETIEEIER
Download sequence
Identical sequences XP_001556910.1.26476 332648.A6RVI9 BC1T_04626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]