SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_05139 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_05139
Domain Number 1 Region: 2-171
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.77e-20
Family N-acetyl transferase, NAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_05139
Sequence length 195
Comment | BC1G_05139 | Botrytis cinerea N-acetyltransferase 5 (196 aa)
Sequence
MTTLRPFSALDVLKFNPTNLDPLTETYDLSFYFSYLARWPHLFTVALSPSSAITGYIMGK
TESSPQSMLLSQSPHYLPWHAHITALTVSPSARRLGLARTLSQVLEKGGEEYDAWFVDLF
VRKSNMIAQELYKGLGYSVFRTVKGYYNEFVGGEEVDEGEGEDAYDMRKPLRRDKNLKHV
RENGESFEVMPEDVW
Download sequence
Identical sequences G2YCC1 M7UZZ6
XP_001555765.1.26476 332648.A6RZ80 BC1T_05139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]