SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_05326 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_05326
Domain Number 1 Region: 8-337
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-73
Family NagZ-like 0.0001
Further Details:      
 
Domain Number 2 Region: 531-696
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000118
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_05326
Sequence length 948
Comment | BC1G_05326 | Botrytis cinerea beta-hexosaminidase (949 aa)
Sequence
MKGHGTYRCFMMGFEGTEVTPQIRTLIEDHHLGAILLSTKNMKSARETANLVQELQTIAH
QAGHLVPLIIALDQENGGVNSLFDEDYICQFPSAMGMAATGSLELAYEVANATAKELSAV
GVNMIMGPCLDVLTNARYQPLGVRATGDDPQEVSQYGIAAMNGYKDAGLASCGKHFPSYG
NLDFLGSSLDMPIITETLEQLSLGALVPFRNAIREGMDSIMVGGCAIANAGMNVMHACLS
DQVVDDLLRNDLGFNGVVVSECLEMEALSHDIGVRGGTVMAVEAGCDLVLLCRSYSVQRE
AIAGLKLGLENDMISRERINLSLKRVLRVKSQCTSWAKALNPPGISHLTSLHPGHLALST
KAYDNSITIMRDKGHLLPLSNSYSEDDDDLLLLTPLVKPLPASTATLGHDNAKSTNNESE
KSHKSSIMSGEGVFRELGRALARQRHGRLLHTSYTANGVRPVHENLINRAGTIIIITADA
TRNLYQNGFTKHVAMMCSMLSSAGKKKSLIVVSVSSPYDFAMDKSIGTYVCTFDFTETAM
KALVRALFGDFVPQGTLPGTLRKSRKVQKSRQHWLVESYNRDRDARGLQALIKSIEKTTP
PNQQSALSGATAGSFEMPSVANHNSLEESHYVVRNSSTQALFGFCSTSYLPSTHTGTIST
LFVDPSKRNLSIGHSLHQRALRHLLLKPNITHLQLGSTLPAIYLGIPMSDLTEGARLKRW
FATNGWDVLSPRFLYTLIIRNVSIWTPPEGLLGTIQRLSLQFDLIQGPSNAATQVLDFVQ
THSSPEIHSIYNLAIMDNRCCGIVRAKSPIDGSLVGTIIISRSETMLSRWMPVLSSSPTQ
SNSISHTNSNNSNSKGKEKEGNRNENSTVGGILAPIIPSNNAQRETILQGLVMLSIRQNK
NKGDGKAVVLNWVVGSDRDVLLGMGFDVLEAWEEVVCEVDRWSDMSLG
Download sequence
Identical sequences BC1T_05326 XP_001556557.1.26476 332648.A6RX61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]