SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_05395 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_05395
Domain Number 1 Region: 205-231,277-459,555-616
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.24e-78
Family N-acetyl transferase, NAT 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BC1T_05395
Sequence length 666
Comment | BC1G_05395 | Botrytis cinerea hypothetical protein similar to MYST (667 aa)
Sequence
MVDKDGVEVEGSRRVSGGRTSTGGRTSIGSGEKRQRGLAEFGITRSPHPQGKKRTREVEK
EEEEEEEGDEIGNTVNGGSMANGTNGTIIGPMSSTQDQEHINTPKRRRISTTNRVNGSIT
VTGTGGRETPRERTRERDVTVSMENSLPSPPAEAGDNEHNVNSVEGDIGRSSPLENNRAG
STGTETETAKNEKENEEEKDEQRERNIDEVVFGDLCFKSWYSSFYTRDVIGNGMIENHSQ
SVSQGSGKSSKSGKSGKSGKSGKGGERDSRGPKGLQVDRLFVCNWCFGYTVHGGEMAKHR
ECCERKGRVPGNCVYEHDENGEWSVWEVDGEVEGTFSQSLSLFAKLFLDNKSVLYDVQSF
NYFLLVHTNPSTKEQQIVGFFSKEKMSWDNNNLACILVFPPWQKKGLGSILIGTSYEISR
REGLLGGPEKPISELGKKGYGRFWGAEVARWLLECEVGVDTLIREEEVEEEEEELDVEVI
KVEKKPPAKKPSGKGMGKGWRKGMKGVGMQPQSLSQSSSQPKEIPAPAPKLTPKATKSAP
KLPVTPPMEDTCGATTVEAISKGTWIAVDDVLGVLRSMGVLEKVGSSNREKAGKKYKVKV
DKEQIRKWIEKEGLSLEKCVREEGFVEGYGYAVSDVSGVSGEESLMESIEGSGEEVDEAG
DEDELA
Download sequence
Identical sequences 332648.A6RY81 XP_001556024.1.26476 BC1T_05395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]