SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_05679 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_05679
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.33e-21
Family N-acetyl transferase, NAT 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_05679
Sequence length 195
Comment | BC1G_05679 | Botrytis cinerea hypothetical protein similar to acetyltransferase (196 aa)
Sequence
MTDPIFHLETPHLFIGYFDANNPIHCTFLVTLYNTPEFIASEGKTAIISPEAARERIATP
FVEEHARNGYGQFLVHLRSDSDPSFSAAMPIGSVCLTKGNNPDSFDVPDVGFALISEVHG
RGYATEAARTLLEYVKKEQGLKNYFGFTSPGNTASMRVMKKLGMVDLGVQPFQGEETHVF
ASPGIGNLEKYGFKN
Download sequence
Identical sequences G2Y682 M7UHV5
XP_001556155.1.26476 332648.A6RXQ0 BC1T_05679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]