SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_08649 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_08649
Domain Number 1 Region: 27-173
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.34e-17
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_08649
Sequence length 207
Comment | BC1G_08649 | Botrytis cinerea predicted protein (208 aa)
Sequence
MSSSSPSPPPSDYRPKFFTKKWTITIPSNPTVRFSRATPSHFDAWLPIATNADNNKLQDS
KDQVWDEVAISKWKDRMHDQYVKSNTDFHCLKVLIEVDGQVMGFGDIFVIRPGIANIGVV
LNEEVRGKGLGKLTTSVLTQLALNFGLQAVAGTMRDNEPMRSTLRNLGFVEEEKIIELEG
RGIVAEFSYTLSREGWKDIDLSVEFEE
Download sequence
Identical sequences M7TSL5
BC1T_08649 XP_001552962.1.26476 332648.A6S774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]