SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_09451 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_09451
Domain Number 1 Region: 4-93,121-187
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000186
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_09451
Sequence length 213
Comment | BC1G_09451 | Botrytis cinerea predicted protein (214 aa)
Sequence
MVLKVEECNDDDMHRVFEIFCQAFGTRHPMIEAIYPNHDTEAGRISGGNRMRDTKNDDPH
TTFLKVVDTDTGAMIAKAKWNIWKGVIPPEKDLDGDYWETAEEKEWAQYLNRDFLVTRRA
AIKEHEGHLVSLDILAVDPAYQRRGAGRLLVKWGTAIADELGYTAVVEASVAGRPLYESE
GFEYVKHCETKIPERFGDRKGEGFIWMVRPAKK
Download sequence
Identical sequences G2Y5E6 M7U2U3
332648.A6SAA5 BC1T_09451 XP_001551745.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]