SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_09897 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_09897
Domain Number 1 Region: 140-270
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.26e-24
Family Ornithine decarboxylase antizyme-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_09897
Sequence length 271
Comment | BC1G_09897 | Botrytis cinerea hypothetical protein similar to ornithine decarboxylase antizyme (272 aa)
Sequence
MAPSMKNSHSSSNCGGEVVSTQANVLASCYIVDSSARLSGFHYSTTGAGGGIPEVRSGSI
SPPSSPPLAALTSANEFALINHSMKNRGRATSRKEGAAYAIREECERLFCENMKTIFLGE
EESASSDSNVMGADTYSSLDDDVDTHDNYFGNVKSGHAIDAWVEIWDYTGGCSFRGFVGG
NGDEKTLFAFFDNSVIGRDLKQGLMALIELADEVFAVSKVVINVDRSIPEEDKSTFLKSL
RWVGFELTTLDMWSHRLDTTSDKWLLMGLEV
Download sequence
Identical sequences 332648.A6SAU3 BC1T_09897 XP_001551730.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]