SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_10146 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  BC1T_10146
Domain Number - Region: 100-165
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00014
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_10146
Sequence length 173
Comment | BC1G_10146 | Botrytis cinerea conserved hypothetical protein (174 aa)
Sequence
MFPDYNSPDLHLAHPTPEEKLATWNLNYEEWGKALSKSDYLHREQYLASVPLTSDDGITY
WCLVDRSSPPNNREIYASCESLRKKAFISKEGKVEEVIIHSIGSVFCPPKNRGRKYASRM
MTDLGNILKTWQLDPNIPGRHSSPASILFSDIGKKFYANHGWHPYPSSHISQE
Download sequence
Identical sequences 332648.A6SC15 BC1T_10146 XP_001551231.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]