SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_11199 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_11199
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.21e-22
Family N-acetyl transferase, NAT 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BC1T_11199
Sequence length 196
Comment | BC1G_11199 | Botrytis cinerea predicted protein (197 aa)
Sequence
MSSYTIKSDRLALEPINLDKHLHGCHKILSEPRIAEWSTRAPSTKLEETKERIMESMASV
QFPMWAIMAPNPSSTSVPLADEREGQEMEMIGIIGISHKPENVGYKIHPDHWGKGYMTEA
LRLFVEMFWTLEEKKSLPQIRAAYTPGNDASARVLEKVGFQTGELLRGEIELWFNRGQNR
KSDIQCMYIDRPRSNE
Download sequence
Identical sequences G2YU48
332648.A6SE72 XP_001550427.1.26476 BC1T_11199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]