SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_11482 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_11482
Domain Number 1 Region: 157-227
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000213
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_11482
Sequence length 257
Comment | BC1G_11482 | Botrytis cinerea conserved hypothetical protein (258 aa)
Sequence
MAHVIEDNSTTMNFLEKKRSLSPATAEEVRVVSISECEEAAQCLAQAFATDEVARYFLDT
DDMSSYSEEYKWKLHCDIIKYMTAAHCYKGIVTTIGPNYDAVALWMPPGQDMDDWLTFFR
SGLWKLYFKLSVEGRKRFYDEFLPLLHHTIDNVMGERNNNFYYLVYLGSKPSARGKGYAK
KLIQHMTDRADRENRPTYLESSAEINLSYYRKLGFEWKQDIVMERGVKPVKMQIMVREPK
FVGETTKEGFVEVEMIE
Download sequence
Identical sequences 332648.A6SEK9 BC1T_11482 XP_001550274.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]