SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_12918 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_12918
Domain Number 1 Region: 153-243
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.05e-19
Family N-acetyl transferase, NAT 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BC1T_12918
Sequence length 290
Comment | BC1G_12918 | Botrytis cinerea predicted protein (291 aa)
Sequence
MTSSDSIAIACAKSLEDFERDYMPPRSSYALYNTSPQSEDVAVKSYKLGLYKPGTLCSQD
LTACLELVEVTSGKHYRESRQGWSGRRKRSEMELWDLRYLVVREVGLGIGEGEGEGEWED
DEDAEGVGNRGGSEKAGEEIIVEERGEEGEGEGEGEGEIKGFMSFMPTFEDGIKVVYLYE
IHLMDELRGTGLGTHLMSLLASIARAIPGVEKTMLTCFTANEAALKFYKKLGYEKDEYSP
EPKRLKGGKVLENDYVILSKRVERTGDERVGDEEDSKEVGVGKGKRKRRV
Download sequence
Identical sequences XP_001548523.1.26476 BC1T_12918 332648.A6SJM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]